{"product_id":"proteintech-14801-1-ap","title":"Proteintech, 14801-1-AP, CRIP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRIP2 (14801-1-AP) by Proteintech is a Polyclonal antibody targeting CRIP2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14801-1-AP targets CRIP2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  MCF-7 cells,  mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRIP2, also known as CRP2 and ESP1, belongs to the cysteine-rich intestinal protein family (CRIP family). The CRIP family is a subfamily of the highly conserved Lin-1, Isl1, Mec3\/double zinc finger protein family that exhibits diverse biological functions. CRIP2 is a cardiac vascular marker, and its expression is detected in cardiac endothelial cells during development and in the adult heart(PMID: 40118853).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6515 Product name: Recombinant human CRIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000434 Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP Predict reactive species\nFull Name: cysteine-rich protein 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 23-29 kDa\nGenBank Accession Number: BC000434\nGene Symbol: CRIP2\nGene ID (NCBI): 1397\nRRID: AB_2245316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52943\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869528182953,"sku":"14801-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14801-1-ap","provider":"Iright","version":"1.0","type":"link"}