{"product_id":"proteintech-14810-1-ap","title":"Proteintech, 14810-1-AP, DCUN1D5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCUN1D5 (14810-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D5 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14810-1-AP targets DCUN1D5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  U-937 cells,  MDA-MB-231 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nConjugation of Nedd8 to a cullin protein, termed neddylation, is an evolutionarily conserved process that functions to activate the cullin-RING family E3 ubiquitin ligases, leading to increased proteasomal degradation of a wide range of substrate proteins. Cellular neddylation requires the action of DCN1 (Defective in cullin neddylation protein 1), which, in humans, consists of five homologues designated as DCNL1-5. DCUN1D5 gene encodes the 28 kDa DCUN1 domain-containing protein 5 containing a C-terminal potentiating neddylation domain. The cellular function of DCUN1D5 needs to be explored, recently, a mono-ubiquitination-mediated mechanism that governs nuclear-cytoplasmic trafficking of hDCNL1, was reported to regulate hDCNL1-dependent activation of the cullin-RING E3 ubiquitin ligases in selected cellular compartments.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6534 Product name: Recombinant human DCUN1D5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC004169 Sequence: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS Predict reactive species\nFull Name: DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC004169\nGene Symbol: DCUN1D5\nGene ID (NCBI): 84259\nRRID: AB_2088468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTE7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869402681513,"sku":"14810-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14810-1-ap","provider":"Iright","version":"1.0","type":"link"}