{"product_id":"proteintech-14830-1-ap","title":"Proteintech, 14830-1-AP, UMPS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UMPS (14830-1-AP) by Proteintech is a Polyclonal antibody targeting UMPS in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n14830-1-AP targets UMPS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  HEK-293T cells,  COLO 320 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6620 Product name: Recombinant human UMPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-480 aa of BC000364 Sequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV Predict reactive species\nFull Name: uridine monophosphate synthetase\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 52 kDa, 45 kDa\nGenBank Accession Number: BC000364\nGene Symbol: UMPS\nGene ID (NCBI): 7372\nRRID: AB_2212392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938031273,"sku":"14830-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14830-1-ap","provider":"Iright","version":"1.0","type":"link"}