{"product_id":"proteintech-14856-1-ap","title":"Proteintech, 14856-1-AP, CTRL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTRL (14856-1-AP) by Proteintech is a Polyclonal antibody targeting CTRL in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14856-1-AP targets CTRL in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue,  BxPC-3 cells\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTRL(Chymotrypsin-like protease) is also named as CTRL1 and belongs to the peptidase S1 family. The CTRL1 enzyme is active over a broad pH range. It expresses in pancreas and presence in intestinal fluid after stimulation of pancreatic secretion as a digestive enzyme(PMID:9065485). This gene encode a protein of 264 amino acid and the protein has a signal peptide of 18 amino acid and a propeptide of 15 amino acid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6644 Product name: Recombinant human CTRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC063475 Sequence: MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Predict reactive species\nFull Name: chymotrypsin-like\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC063475\nGene Symbol: CTRL\nGene ID (NCBI): 1506\nRRID: AB_10640303\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40313\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454913705,"sku":"14856-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14856-1-ap","provider":"Iright","version":"1.0","type":"link"}