{"product_id":"proteintech-14879-1-ap","title":"Proteintech, 14879-1-AP, BTG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTG1 (14879-1-AP) by Proteintech is a Polyclonal antibody targeting BTG1 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n14879-1-AP targets BTG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human thyroid cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTG1 is a member of the TOB\/BTG family of proteins known to inhibit cell proliferation and negatively regulate the cell cycle (PMID: 25017022). It is strongly expressed in quiescent cells (maximal in the G0\/G1 phase) and down-regulated as the cells enter the growth cycle (PMID: 1373383). BTG1 protein is localized in cytoplasm and nucleus, and can interact with CAF1 and PRMT1 (PMID: 1113675, 9712883, 26622543). The aberration of BTG1 expression is associated with B-cell lymphocytic leukemia, and may serve as a diagnostic indicator and prognostic marker of thyroid carcinoma (PMID: 2069907, 25017022).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6651 Product name: Recombinant human BTG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC064953 Sequence: MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG Predict reactive species\nFull Name: B-cell translocation gene 1, anti-proliferative\nCalculated Molecular Weight: 19 kDa\nGenBank Accession Number: BC064953\nGene Symbol: BTG1\nGene ID (NCBI): 694\nRRID: AB_2067644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62324\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939047081,"sku":"14879-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14879-1-ap","provider":"Iright","version":"1.0","type":"link"}