{"product_id":"proteintech-14882-1-ap","title":"Proteintech, 14882-1-AP, NARS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NARS (14882-1-AP) by Proteintech is a Polyclonal antibody targeting NARS in WB, IP, IHC, ELISA applications with reactivity to human samples\n14882-1-AP targets NARS in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAsparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis\/prognosis (PMID: 27161446).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6656 Product name: Recombinant human NARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-548 aa of BC001687 Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP Predict reactive species\nFull Name: asparaginyl-tRNA synthetase\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC001687\nGene Symbol: NARS\nGene ID (NCBI): 4677\nRRID: AB_2151040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43776\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869714403497,"sku":"14882-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14882-1-ap","provider":"Iright","version":"1.0","type":"link"}