{"product_id":"proteintech-14895-1-ap","title":"Proteintech, 14895-1-AP, RBX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBX1 (14895-1-AP) by Proteintech is a Polyclonal antibody targeting RBX1 in WB, IP, IHC, ELISA applications with reactivity to human samples\n14895-1-AP targets RBX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40.It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, eriocheir sinensis\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6685 Product name: Recombinant human RBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species\nFull Name: ring-box 1\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC001466\nGene Symbol: RBX1\nGene ID (NCBI): 9978\nRRID: AB_2179719\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62877\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899135657,"sku":"14895-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14895-1-ap","provider":"Iright","version":"1.0","type":"link"}