{"product_id":"proteintech-14901-1-ap","title":"Proteintech, 14901-1-AP, PECR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PECR (14901-1-AP) by Proteintech is a Polyclonal antibody targeting PECR in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n14901-1-AP targets PECR in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human testis tissue,  human kidney tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxisomal trans-2-enoyl-CoA reductase (PECR) is also called TERP and TECR, which is located on chromosome q35 with 86627 bases. It can participate in carbon chain elongation in fatty acid metabolism and catalyze the last reaction of four long chain fatty acid elongation cycles. Each cycle of PECR adds two carbons to the long chain and very long chain fatty acid (VLCFA) chains, reducing the intermediate of trans-2,3-enoyl coenzyme A fatty acid to acyl coenzyme A, which can further extend the carbon chain by entering a new elongation cycle. Meanwhile, PECR is a peroxisome protein involved in fatty acid synthesis and plays an important role in milk fat synthesis. The molecular mass of PECR is 33 kDa. (PMID: 31467878)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6693 Product name: Recombinant human PECR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC002529 Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL Predict reactive species\nFull Name: peroxisomal trans-2-enoyl-CoA reductase\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC002529\nGene Symbol: PECR\nGene ID (NCBI): 55825\nRRID: AB_2161166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BY49\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869571010729,"sku":"14901-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14901-1-ap","provider":"Iright","version":"1.0","type":"link"}