{"product_id":"proteintech-14920-1-ap","title":"Proteintech, 14920-1-AP, ATP6V1D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V1D (14920-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1D in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14920-1-AP targets ATP6V1D in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, mouse skeletal muscle tissue,  mouse lung tissue,  rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP6V1D is also named as ATP6M, VATD(V-type proton ATPase subunit D) and belongs to the V-ATPase D subunit family. ATP6V1D gene has been under strong negative selection during evolution and is highly conserved among mammals, flies, worms, yeast, plants, and bacteria(PMID:11435709). It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6737 Product name: Recombinant human ATP6V1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC001411 Sequence: MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC001411\nGene Symbol: ATP6V1D\nGene ID (NCBI): 51382\nRRID: AB_2243302\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5K8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922892457,"sku":"14920-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14920-1-ap","provider":"Iright","version":"1.0","type":"link"}