{"product_id":"proteintech-14927-1-ap","title":"Proteintech, 14927-1-AP, TIM22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIM22 (14927-1-AP) by Proteintech is a Polyclonal antibody targeting TIM22 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14927-1-AP targets TIM22 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIM22 is a translocase localized in mitochondrial inner membrane. It is implicated in import of nuclear-encoded mitochondrial preproteins to the mitochondria. TIM22 is the essential core of protein insertion complex (TIM22 complex) that consists of TIM22, TIM54, TIM18, and TIM12.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6689 Product name: Recombinant human TIMM22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC002324 Sequence: MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 22 homolog (yeast)\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC002324\nGene Symbol: TIM22\nGene ID (NCBI): 29928\nRRID: AB_11183050\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855947433,"sku":"14927-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14927-1-ap","provider":"Iright","version":"1.0","type":"link"}