{"product_id":"proteintech-14933-1-ap","title":"Proteintech, 14933-1-AP, GALNS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GALNS (14933-1-AP) by Proteintech is a Polyclonal antibody targeting GALNS in WB, IHC, ELISA applications with reactivity to human samples\n14933-1-AP targets GALNS in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, human liver tissue,  HepG2 cells,  HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGALNS(N-acetylgalactosamine-6-sulfatase) is also named as chondroitinase and belongs to the sulfatase family. It is one of sulfatases required to degrade glycosaminoglycans (GAGs), keratan sulfate (KS) and chondroitin-6-sulfate (C6S) and the enzyme is a dimer derived from two 60 kDa polypeptides, each of which is processed to 40 kDa and 15 kDa polypeptide subunits linked by disulfide bonds(PMID:15241807). The deduced 522-residue protein is composed of a 26-amino acid N-terminal signal peptide and a mature polypeptide of 496 amino acid residues, including 2 potential asparagine-linked glycosylation sites(PMID:1755850). Defects in GALNS are the cause of mucopolysaccharidosis type 4A (MPS4A), also known as Morquio A syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6746 Product name: Recombinant human GALNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-522 aa of BC050684 Sequence: ARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH Predict reactive species\nFull Name: galactosamine (N-acetyl)-6-sulfate sulfatase\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC050684\nGene Symbol: GALNS\nGene ID (NCBI): 2588\nRRID: AB_2108720\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P34059\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869685960873,"sku":"14933-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14933-1-ap","provider":"Iright","version":"1.0","type":"link"}