{"product_id":"proteintech-14958-1-ap","title":"Proteintech, 14958-1-AP, RBM8A,Y14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM8A,Y14 (14958-1-AP) by Proteintech is a Polyclonal antibody targeting RBM8A,Y14 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14958-1-AP targets RBM8A,Y14 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Jurkat cells,  HeLa cells,  MDA-MB-453s cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human brain tissue, human spleen tissue,  human testis tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6800 Product name: Recombinant human RBM8A,Y14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-174 aa of BC017088 Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Predict reactive species\nFull Name: RNA binding motif protein 8A\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC017088\nGene Symbol: RBM8A\nGene ID (NCBI): 9939\nRRID: AB_2178820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5S9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008580777,"sku":"14958-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14958-1-ap","provider":"Iright","version":"1.0","type":"link"}