{"product_id":"proteintech-14970-1-ap","title":"Proteintech, 14970-1-AP, TRMT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRMT1 (14970-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14970-1-AP targets TRMT1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:600-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRMT1 is an RNA methyltransferase responsible for the formation of N2,N2-dimethylguanosine (m2,2G) at position 26 in both cytosolic and mitochondrial tRNAs.TRMT1-catalyzed tRNA modifications are important for maintenance of global protein translation levels including proteins involved in cellular growth, development, and stress response. Human neural stem cells with TRMT1 knockdowns were found to have hypersensitivity to redox stress, implicating TRMT1 and the m2,2G26 modification in the regulation of redox homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6837 Product name: Recombinant human TRMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-659 aa of BC002492 Sequence: KFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID Predict reactive species\nFull Name: TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC002492\nGene Symbol: TRMT1\nGene ID (NCBI): 55621\nRRID: AB_2209504\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXH9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887839400105,"sku":"14970-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14970-1-ap","provider":"Iright","version":"1.0","type":"link"}