{"product_id":"proteintech-14977-1-ap","title":"Proteintech, 14977-1-AP, SNRPF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPF (14977-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14977-1-AP targets SNRPF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  HeLa cells,  HepG2 cells,  MCF-7 cells,  mouse kidney tissue,  mouse liver tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4\/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B\/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6889 Product name: Recombinant human SNRPF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC002505 Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide F\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC002505\nGene Symbol: SNRPF\nGene ID (NCBI): 6636\nRRID: AB_2302166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62306\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869603614889,"sku":"14977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14977-1-ap","provider":"Iright","version":"1.0","type":"link"}