{"product_id":"proteintech-14987-1-ap","title":"Proteintech, 14987-1-AP, S100A13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A13 (14987-1-AP) by Proteintech is a Polyclonal antibody targeting S100A13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14987-1-AP targets S100A13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IHC detected in: human thyroid cancer tissue,  human brain tissue,  human heart tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissue,  human testis tissue,  human thyroid tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6971 Product name: Recombinant human S100A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC000632 Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK Predict reactive species\nFull Name: S100 calcium binding protein A13\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC000632\nGene Symbol: S100A13\nGene ID (NCBI): 6284\nRRID: AB_2878097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869495808169,"sku":"14987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-14987-1-ap","provider":"Iright","version":"1.0","type":"link"}