{"product_id":"proteintech-15005-1-ap","title":"Proteintech, 15005-1-AP, Trypsin 2\/PRSS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Trypsin 2\/PRSS2 (15005-1-AP) by Proteintech is a Polyclonal antibody targeting Trypsin 2\/PRSS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15005-1-AP targets Trypsin 2\/PRSS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells,  HepG2 cells,  mouse thymus tissue\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human pancreas produces three isoforms of trypsinogen encoded by separate genes, the PRSS1 (protease, serine 1), PRSS2, and PRSS3 genes. PRSS2 is also named as TRY2(trypsin-2), TRYP2. In the ileum, it may be involved in defensin processing, including DEFA5. The preproprotein comprises 247 amino acids, including a 15-amino acid signal peptide and an 8-amino acid activation peptide.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6461 Product name: Recombinant human PRSS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-239 aa of BC030260 Sequence: MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI Predict reactive species\nFull Name: protease, serine, 2 (trypsin 2)\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa, 35 kDa\nGenBank Accession Number: BC030260\nGene Symbol: PRSS2\nGene ID (NCBI): 5645\nRRID: AB_2171841\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07478\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869438431401,"sku":"15005-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15005-1-ap","provider":"Iright","version":"1.0","type":"link"}