{"product_id":"proteintech-15027-1-ap","title":"Proteintech, 15027-1-AP, NUP85 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUP85 (15027-1-AP) by Proteintech is a Polyclonal antibody targeting NUP85 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15027-1-AP targets NUP85 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HepG2 cells\nPositive IHC detected in: rat brain tissue, human stomach cancer tissue,  mouse brain tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThis gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. NPCs are key for nucleocytoplasmic transport, but also regulate the mitotic machinery, transcription and chromatin organization through transport-independent mechanisms. The NUP107-160 complex is acknowledged to contribute to the assembly and maintenance of the NPC structure. Members of this largest subcomplex of the NPC associate with kinetochores, mitotic spindles, centrosomes and mitotic checkpoint regulators for proper completion of the cell cycle . Downregulation of NUP107-160 subcomplex members resulted in defective cytokinesis, compromised microtubule structures, altered cytoskeletal dynamics, impaired chromosome segregation and differentiation. (PMID:34170319)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7158 Product name: Recombinant human Pericentrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 307-656 aa of BC000697 Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS Predict reactive species\nFull Name: nucleoporin 85kDa\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC000697\nGene Symbol: NUP85\nGene ID (NCBI): 79902\nRRID: AB_3085449\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BW27\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869568356521,"sku":"15027-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15027-1-ap","provider":"Iright","version":"1.0","type":"link"}