{"product_id":"proteintech-15032-1-ap","title":"Proteintech, 15032-1-AP, PHF17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF17 (15032-1-AP) by Proteintech is a Polyclonal antibody targeting PHF17 in WB, ELISA applications with reactivity to human samples\n15032-1-AP targets PHF17 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHF17 was identified as a protein partner of the von Hippel-Lindau tumor suppressor pVHL. It is one component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. It can act as a transcriptional coactivator that promote acetylation of nucleosomal histone H4 by KAT5. In addition, it ubiquitinates both phosphorylated and non-phosphorylated β-catenin and therefore regulates canonical Wnt signaling in both Wnt-off and Wnt-on phases. PHF17 exist several isoforms with molecular weight 100-110 and 55-65 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4290 Product name: Recombinant human PHF17 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-300 aa of BC032376 Sequence: MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI Predict reactive species\nFull Name: PHD finger protein 17\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 65 kDa, 100-110 kDa\nGenBank Accession Number: BC032376\nGene Symbol: PHF17\nGene ID (NCBI): 79960\nRRID: AB_2165238\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6IE81\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986429609,"sku":"15032-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15032-1-ap","provider":"Iright","version":"1.0","type":"link"}