{"product_id":"proteintech-15042-1-ap","title":"Proteintech, 15042-1-AP, AZI2\/NAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AZI2\/NAP1 (15042-1-AP) by Proteintech is a Polyclonal antibody targeting AZI2\/NAP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15042-1-AP targets AZI2\/NAP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IP detected in: HEK-293 cells, HepG2 cells\nPositive IHC detected in: mouse testis tissue, human pancreas tissue,  human stomach tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6892 Product name: Recombinant human AZI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC001139 Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH Predict reactive species\nFull Name: 5-azacytidine induced 2\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC001139\nGene Symbol: AZI2\nGene ID (NCBI): 64343\nRRID: AB_2878103\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6S1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993310889,"sku":"15042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15042-1-ap","provider":"Iright","version":"1.0","type":"link"}