{"product_id":"proteintech-15048-1-ap","title":"Proteintech, 15048-1-AP, RTN1 (Isoform RTN1-C) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RTN1 (Isoform RTN1-C) (15048-1-AP) by Proteintech is a Polyclonal antibody targeting RTN1 (Isoform RTN1-C) in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15048-1-AP targets RTN1 (Isoform RTN1-C) in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, human brain tissue,  human placenta tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN1 (also known as NSP) gene is expressed predominantly in neuroendocrine tissues, and produces three isoforms termed RTN1-A (NSP-A), RTN1-B (NSP-B), and RTN1-C (NSP-C). This antibody is raised against the full-length protein of human RTN1-C.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7031 Product name: Recombinant human RTN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000314 Sequence: MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE Predict reactive species\nFull Name: reticulon 1\nCalculated Molecular Weight: 84 kDa, 39 kDa, 24 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC000314\nGene Symbol: RTN1-C\nGene ID (NCBI): 6252\nRRID: AB_2185981\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16799\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988362921,"sku":"15048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15048-1-ap","provider":"Iright","version":"1.0","type":"link"}