{"product_id":"proteintech-15059-1-ap","title":"Proteintech, 15059-1-AP, HPRT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HPRT (15059-1-AP) by Proteintech is a Polyclonal antibody targeting HPRT in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15059-1-AP targets HPRT in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  A549 cells,  mouse liver tissue,  MCF-7 cells,  HepG2 cells,  Jurkat cells,  Y79 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human liver cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7044 Product name: Recombinant human HPRT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC000578 Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Predict reactive species\nFull Name: hypoxanthine phosphoribosyltransferase 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 24-28 kDa\nGenBank Accession Number: BC000578\nGene Symbol: HPRT1\nGene ID (NCBI): 3251\nRRID: AB_10638622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00492\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852605097,"sku":"15059-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15059-1-ap","provider":"Iright","version":"1.0","type":"link"}