{"product_id":"proteintech-15071-1-ap","title":"Proteintech, 15071-1-AP, TOMM7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOMM7 (15071-1-AP) by Proteintech is a Polyclonal antibody targeting TOMM7 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n15071-1-AP targets TOMM7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human gliomas tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7105 Product name: Recombinant human TOMM7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC001732 Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG Predict reactive species\nFull Name: translocase of outer mitochondrial membrane 7 homolog (yeast)\nCalculated Molecular Weight: 6 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC001732\nGene Symbol: TOMM7\nGene ID (NCBI): 54543\nRRID: AB_11232410\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388165289,"sku":"15071-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15071-1-ap","provider":"Iright","version":"1.0","type":"link"}