{"product_id":"proteintech-15079-1-ap","title":"Proteintech, 15079-1-AP, VPS8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS8 (15079-1-AP) by Proteintech is a Polyclonal antibody targeting VPS8 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15079-1-AP targets VPS8 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human testis tissue,  mouse brain tissue,  mouse liver tissue,  PC-3 cells\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS8, also named as KIAA0804, has some isoforms with MW 135-160 kDa and 70-90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7151 Product name: Recombinant human VPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-147 aa of BC001001 Sequence: MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED Predict reactive species\nFull Name: vacuolar protein sorting 8 homolog (S. cerevisiae)\nCalculated Molecular Weight: 162 kDa\nObserved Molecular Weight: 151 kDa\nGenBank Accession Number: BC001001\nGene Symbol: VPS8\nGene ID (NCBI): 23355\nRRID: AB_2215543\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N3P4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869440168105,"sku":"15079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15079-1-ap","provider":"Iright","version":"1.0","type":"link"}