{"product_id":"proteintech-15102-1-ap","title":"Proteintech, 15102-1-AP, IL-10RB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-10RB (15102-1-AP) by Proteintech is a Polyclonal antibody targeting IL-10RB in WB, ELISA applications with reactivity to human,  mouse, rat samples\n15102-1-AP targets IL-10RB in WB, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skeletal muscle tissue, Jurkat cells,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A\/B and IL29 (PMID: 22236434).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7445 Product name: Recombinant human IL-10RB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-225 aa of BC001903 Sequence: LGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAV Predict reactive species\nFull Name: interleukin 10 receptor, beta\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC001903\nGene Symbol: IL10RB\nGene ID (NCBI): 3588\nRRID: AB_10638926\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08334\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869412479145,"sku":"15102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15102-1-ap","provider":"Iright","version":"1.0","type":"link"}