{"product_id":"proteintech-15118-1-ap","title":"Proteintech, 15118-1-AP, HCCS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HCCS (15118-1-AP) by Proteintech is a Polyclonal antibody targeting HCCS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n15118-1-AP targets HCCS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  HeLa cells,  MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHCCS(Cytochrome c-type heme lyase) links covalently the heme group to the apoprotein of cytochrome C.The covalent attachment of heme by CCHL in the IMS is crucial for translocation of the precursor of cytochrome c and its trapping in the IMS(PMID:15359280 ).This protein has  a calculated molecular mass of about 31 KDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7189 Product name: Recombinant human HCCS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC001691 Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS Predict reactive species\nFull Name: holocytochrome c synthase (cytochrome c heme-lyase)\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC001691\nGene Symbol: HCCS\nGene ID (NCBI): 3052\nRRID: AB_2114848\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53701\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868981317801,"sku":"15118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15118-1-ap","provider":"Iright","version":"1.0","type":"link"}