{"product_id":"proteintech-15119-1-ap","title":"Proteintech, 15119-1-AP, SCAMP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCAMP2 (15119-1-AP) by Proteintech is a Polyclonal antibody targeting SCAMP2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15119-1-AP targets SCAMP2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells,  human liver tissue,  mouse lung tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCAMP2 functions in post-Golgi recycling pathways. It acts as a recycling carrier to the cell surface. It couples Arf6-stimulated PLD activity to exocytosis and links this process to formation of fusion pores. SCAMP2 is marker for secretory vesicles and tobacco BY-2 cells as a model system. The MW of SCAMP2 is 36-39 kDa with modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7190 Product name: Recombinant human SCAMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC001376 Sequence: MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML Predict reactive species\nFull Name: secretory carrier membrane protein 2\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC001376\nGene Symbol: SCAMP2\nGene ID (NCBI): 10066\nRRID: AB_2184772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15127\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869594538153,"sku":"15119-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15119-1-ap","provider":"Iright","version":"1.0","type":"link"}