{"product_id":"proteintech-15144-1-ap","title":"Proteintech, 15144-1-AP, PPIL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPIL1 (15144-1-AP) by Proteintech is a Polyclonal antibody targeting PPIL1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15144-1-AP targets PPIL1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A375 cells,  NIH\/3T3 cells,  HepG2 cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeptidyl-prolyl isomerase (PPIase) catalyzes the interconversion of a specific Pro-imide bond between the cis and trans conformations. PPIL1 (Peptidyl-prolyl cis-trans isomerase-like 1) is up-regulated in human colon cancer cells and an siRNA-mediated knockdown of PPIL1 resulted in a reduced number of viable cell (PMID: 20368803). Expression of PPIL1 was shown to be ubiquitous across all adult tissues (with highest expression in the adrenal gland, testis and heart). PPIL1 is also known to participate in the spliceosome; a complex and dynamic protein and RNA complex responsible for splicing introns from pre-mRNA (PMID: 33220177, 8978786).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7436 Product name: Recombinant human PPIL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC003048 Sequence: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Predict reactive species\nFull Name: peptidylprolyl isomerase (cyclophilin)-like 1\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC003048\nGene Symbol: PPIL1\nGene ID (NCBI): 51645\nRRID: AB_2169603\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3C6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869575958697,"sku":"15144-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15144-1-ap","provider":"Iright","version":"1.0","type":"link"}