{"product_id":"proteintech-15170-1-ap","title":"Proteintech, 15170-1-AP, CRAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRAT (15170-1-AP) by Proteintech is a Polyclonal antibody targeting CRAT in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15170-1-AP targets CRAT in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse heart tissue,  rat skeletal muscle,  rat heart tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:800-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRAT, also named as CAT1, belongs to the carnitine\/choline acetyltransferase family. It is specific for short chain fatty acids. CRAT seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CRAT is an active forms for carnitine acetyltransferase. This antibody can bind the close sequences genes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7422 Product name: Recombinant human CRAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-281 aa of BC000723 Sequence: MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQK Predict reactive species\nFull Name: carnitine acetyltransferase\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 62-68 kDa\nGenBank Accession Number: BC000723\nGene Symbol: CRAT\nGene ID (NCBI): 1384\nRRID: AB_2229978\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43155\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901396649,"sku":"15170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15170-1-ap","provider":"Iright","version":"1.0","type":"link"}