{"product_id":"proteintech-15205-1-ap","title":"Proteintech, 15205-1-AP, FADS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FADS3 (15205-1-AP) by Proteintech is a Polyclonal antibody targeting FADS3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15205-1-AP targets FADS3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, EC109 cells,  L02 cells,  mouse kidney tissue,  mouse skeletal muscle tissue,  mouse liver tissue,  rat skeletal muscle tissue\nPositive IP detected in: L02 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFADS3, also named as CYB5RP, belongs to fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family memebers are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase protion, both of which are characterized by conserved histidine motifs. FADS3 can be detected as 40 kDa-51 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7355 Product name: Recombinant human FADS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC004901 Sequence: MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA Predict reactive species\nFull Name: fatty acid desaturase 3\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 41-51 kDa\nGenBank Accession Number: BC004901\nGene Symbol: FADS3\nGene ID (NCBI): 3995\nRRID: AB_10859776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5Q0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629619369,"sku":"15205-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15205-1-ap","provider":"Iright","version":"1.0","type":"link"}