{"product_id":"proteintech-15209-1-ap","title":"Proteintech, 15209-1-AP, DDX19A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX19A (15209-1-AP) by Proteintech is a Polyclonal antibody targeting DDX19A in WB, IHC, ELISA applications with reactivity to human samples\n15209-1-AP targets DDX19A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  K-562 cells,  HeLa cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX19A, also known as DDX19L, belongs to the DEAD-box helicase family. DDX19A was identified as a novel cytosolic RNA sensor that could activate the NLRP3 inflammasome during virus infection. In addition, DDX19A was proven to be associated with NADPH oxidase 1 (NOX1)-mediated oxidative stress in tumor necrosis factor (TNF)-α-induced A549 cell (PMID: 33968728). DDX19A has 2 isoforms with the molecular mass of 44 and 54 kDa.  DDX19A may represent biomarkers of metastasis and novel therapeutic targets in CSCC patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7362 Product name: Recombinant human DDX19A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-478 aa of BC005162 Sequence: MMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-As) box polypeptide 19A\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 44 kDa and 54 kDa\nGenBank Accession Number: BC005162\nGene Symbol: DDX19A\nGene ID (NCBI): 55308\nRRID: AB_3085451\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869672853673,"sku":"15209-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15209-1-ap","provider":"Iright","version":"1.0","type":"link"}