{"product_id":"proteintech-15210-1-ap","title":"Proteintech, 15210-1-AP, DAZAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DAZAP2 (15210-1-AP) by Proteintech is a Polyclonal antibody targeting DAZAP2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15210-1-AP targets DAZAP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, C6 cells,  J774A.1 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAZAP2, also named KIAA0058, has six isoforms. In unstressed cells, it promotes SIAH1-mediated polyubiquitination and degradation of the serine\/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, it localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53\/p53 target genes by binding to TP53 at target gene promoters (PMID: 33591310).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7364 Product name: Recombinant human DAZAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC002334 Sequence: MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW Predict reactive species\nFull Name: DAZ associated protein 2\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa, 22 kDa\nGenBank Accession Number: BC002334\nGene Symbol: DAZAP2\nGene ID (NCBI): 9802\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15038\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887060766889,"sku":"15210-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15210-1-ap","provider":"Iright","version":"1.0","type":"link"}