{"product_id":"proteintech-15214-1-ap","title":"Proteintech, 15214-1-AP, GSTM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTM3 (15214-1-AP) by Proteintech is a Polyclonal antibody targeting GSTM3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15214-1-AP targets GSTM3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, human testis tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7375 Product name: Recombinant human GSTM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC000088 Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC Predict reactive species\nFull Name: glutathione S-transferase mu 3 (brain)\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-29 kDa\nGenBank Accession Number: BC000088\nGene Symbol: GSTM3\nGene ID (NCBI): 2947\nRRID: AB_2116070\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21266\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876492969,"sku":"15214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15214-1-ap","provider":"Iright","version":"1.0","type":"link"}