{"product_id":"proteintech-15267-1-ap","title":"Proteintech, 15267-1-AP, ARL4D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL4D (15267-1-AP) by Proteintech is a Polyclonal antibody targeting ARL4D in WB, ELISA applications with reactivity to human, mouse, rat samples\n15267-1-AP targets ARL4D in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue, Y79 cells,  rat retina tiissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL4D (ADP-ribosylation factor-like protein 4D) is also named as ARF4L.  ARL4D is a developmentally regulated member of the ADP-ribosylation factor\/ARF-like protein (ARF\/ARL) family of Ras-related GTPases. ARL4D interacts with the C-terminal pleckstrin homology (PH) and polybasic c domains of cytohesin-2\/ARNO in a GTP-dependent manner. Localization of ARL4D at the plasma membrane is GTP- and N-terminal myristoylation-dependent. ARL4D(Q80L), a putative active form of ARL4D, induced accumulation of cytohesin-2\/ARNO at the plasma membrane  (PMID: 17804820).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7369 Product name: Recombinant human ARL4D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC000043 Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR Predict reactive species\nFull Name: ADP-ribosylation factor-like 4D\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 25-27 kDa\nGenBank Accession Number: BC000043\nGene Symbol: ARL4D\nGene ID (NCBI): 379\nRRID: AB_3669203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49703\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885045862569,"sku":"15267-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15267-1-ap","provider":"Iright","version":"1.0","type":"link"}