{"product_id":"proteintech-15269-1-ap","title":"Proteintech, 15269-1-AP, COLEC11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COLEC11 (15269-1-AP) by Proteintech is a Polyclonal antibody targeting COLEC11 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15269-1-AP targets COLEC11 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, human plasma\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: ATCD5 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOLEC11, also named as CL-K1 and Collectin-11, belongs to the COLEC10\/COLEC11 family. It is a lectin that binds to various sugars: fucose \u0026gt; mannose. It does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. COLEC11 binds to LPS. COLEC11 and MASP1 are two genes in the lectin complement pathway, they are mutated in 3MC syndrome, implicating this diverse inflammation-chemotaxis cascade in the etiology of human developmental disorders. COLEC11 serves as a guidance cue for neural crest cell migration.(PMID:21258343)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7374 Product name: Recombinant human COLEC11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-271 aa of BC000078 Sequence: SLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM Predict reactive species\nFull Name: collectin sub-family member 11\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000078\nGene Symbol: COLEC11\nGene ID (NCBI): 78989\nRRID: AB_10732940\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWP8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868950646953,"sku":"15269-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15269-1-ap","provider":"Iright","version":"1.0","type":"link"}