{"product_id":"proteintech-15280-1-ap","title":"Proteintech, 15280-1-AP, ATP6V1E1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V1E1 (15280-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1E1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15280-1-AP targets ATP6V1E1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human liver tissue,  human brain tissue,  mouse brain tissue,  HEK-293 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse testis tissue, human testis tissue,  mouse kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP6V1E1, also named as ATP6E, ATP6E2 and p31, belongs to the V-ATPase E subunit family. It is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase and the lack of mycobacterial phagosome acidification are directly attributed to the Mtb protein tyrosine phosphatase PtpA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7399 Product name: Recombinant human ATP6V1E1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC004443 Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC004443\nGene Symbol: ATP6V1E1\nGene ID (NCBI): 529\nRRID: AB_2062545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905230505,"sku":"15280-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15280-1-ap","provider":"Iright","version":"1.0","type":"link"}