{"product_id":"proteintech-15287-1-ap","title":"Proteintech, 15287-1-AP, HSPB8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPB8 (15287-1-AP) by Proteintech is a Polyclonal antibody targeting HSPB8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15287-1-AP targets HSPB8 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, SGC-7901 cells,  mouse brain tissue,  HEK-293 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human heart tissue,  human brain tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Heat Shock Protein B8 (HSPB8), also named small stress protein-like protein (sHSP22), protein kinase H11(H11), E2-induced gene 1 protein (E2IG1), or alpha-crystallin C chain (CRYAC), is a small chaperone involved in chaperone-assisted selective autophagy (CASA) (PMID: 33562660). HSPB8 is expressed at relatively high levels in the heart and the skeletal muscle tissue. HSPB8 is composed of 196 amino acids with an apparent molecular mass of 21.6 kDa (PMID: 20570967).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7456 Product name: Recombinant human HSPB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC002673 Sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT Predict reactive species\nFull Name: heat shock 22kDa protein 8\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 20-22 kDa\nGenBank Accession Number: BC002673\nGene Symbol: HSPB8\nGene ID (NCBI): 26353\nRRID: AB_2248640\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902477993,"sku":"15287-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15287-1-ap","provider":"Iright","version":"1.0","type":"link"}