{"product_id":"proteintech-15314-1-ap","title":"Proteintech, 15314-1-AP, TSPAN14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN14 (15314-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN14 in WB, ELISA applications with reactivity to human samples\n15314-1-AP targets TSPAN14 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN14 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN14 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN15, TSPAN17, and TSPAN33. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7551 Product name: Recombinant human TSPAN14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-219 aa of BC002920 Sequence: LFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIV Predict reactive species\nFull Name: tetraspanin 14\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC002920\nGene Symbol: TSPAN14\nGene ID (NCBI): 81619\nRRID: AB_2918039\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NG11\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782298793,"sku":"15314-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15314-1-ap","provider":"Iright","version":"1.0","type":"link"}