{"product_id":"proteintech-15321-1-ap","title":"Proteintech, 15321-1-AP, PAM16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAM16 (15321-1-AP) by Proteintech is a Polyclonal antibody targeting PAM16 in WB, IHC, ELISA applications with reactivity to human samples\n15321-1-AP targets PAM16 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAM16, also named as Magmas, TIM16 and TIMM16, is regulates ATP-dependent protein translocation into the mitochondrial matrix. The MW of PAM16 is about 14-16 kDa in WB detection. PAM16 is a component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16\/PAM16 and TIMM14\/DNAJC19.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0970 Product name: Recombinant human PAM16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC005024 Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERP Predict reactive species\nFull Name: mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC005024\nGene Symbol: PAM16\nGene ID (NCBI): 51025\nRRID: AB_2878126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3D7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420966057,"sku":"15321-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15321-1-ap","provider":"Iright","version":"1.0","type":"link"}