{"product_id":"proteintech-15332-1-ap","title":"Proteintech, 15332-1-AP, TPSB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPSB2 (15332-1-AP) by Proteintech is a Polyclonal antibody targeting TPSB2 in WB, ELISA applications with reactivity to human, mouse samples\n15332-1-AP targets TPSB2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTryptase beta-2 (TPSB2), also known as TPS2, is a member of the peptidase S1 family and the mast cell-specific tryptase subfamily. It is a serine protease primarily expressed in mast cells and basophils. TPSB2 is synthesized as a proenzyme, stored in secretory granules, and released upon cell activation. It plays a crucial role in allergic reactions and inflammation by cleaving extracellular matrix proteins, activating protease-activated receptors (PARs), and processing cytokines like IL-33. Elevated levels of TPSB2 are associated with conditions such as asthma, allergic rhinitis, and anaphylaxis, making it a biomarker and therapeutic target in these areas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7335 Product name: Recombinant human TPSB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-282 aa of BC065923 Sequence: LQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP Predict reactive species\nFull Name: tryptase beta 2\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC065923\nGene Symbol: TPSB2\nGene ID (NCBI): 64499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20231\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887836418217,"sku":"15332-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15332-1-ap","provider":"Iright","version":"1.0","type":"link"}