{"product_id":"proteintech-15337-1-ap","title":"Proteintech, 15337-1-AP, CLPTM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLPTM1 (15337-1-AP) by Proteintech is a Polyclonal antibody targeting CLPTM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15337-1-AP targets CLPTM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: A549 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCleft lip and palate transmembrane protein 1 (CLPTM1), a multipass transmembrane protein, was identified due to the association of a chromosomal translocation with a cleft lip and palate (PMID: 9828125). CLPTM1 regulates epileptic seizures by modulating GABAAR-mediated inhibitory synaptic transmission (PMID: 36519412). Highly expressed CLPTM1L may contribute to a poor prognosis and increase invasion, proliferation and migration of oral squamous cell carcinoma (PMID: 34586883).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7538 Product name: Recombinant human CLPTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC004865 Sequence: MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALLE Predict reactive species\nFull Name: cleft lip and palate associated transmembrane protein 1\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 65-75 kDa\nGenBank Accession Number: BC004865\nGene Symbol: CLPTM1\nGene ID (NCBI): 1209\nRRID: AB_3669204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O96005\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886640812201,"sku":"15337-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15337-1-ap","provider":"Iright","version":"1.0","type":"link"}