{"product_id":"proteintech-15346-1-ap","title":"Proteintech, 15346-1-AP, CKMT1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CKMT1A (15346-1-AP) by Proteintech is a Polyclonal antibody targeting CKMT1A in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15346-1-AP targets CKMT1A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat heart tissue, human colon tissue,  human testis tissue,  mouse heart tissue,  mouse testis tissue,  HEK-293 cells,  A549 cells\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, sus scrofa domesticus (domestic pig)\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7583 Product name: Recombinant human CKMT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-417 aa of BC001926 Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH Predict reactive species\nFull Name: creatine kinase, mitochondrial 1A\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC001926\nGene Symbol: CKMT1A\nGene ID (NCBI): 548596\nRRID: AB_2081073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12532\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875968681,"sku":"15346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15346-1-ap","provider":"Iright","version":"1.0","type":"link"}