{"product_id":"proteintech-15354-1-ap","title":"Proteintech, 15354-1-AP, MYL9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL9 (15354-1-AP) by Proteintech is a Polyclonal antibody targeting MYL9 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n15354-1-AP targets MYL9 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, Caco-2 cells,  rat colon tissue\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive IF\/ICC detected in: MCF-7 cells, C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:5000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyosin regulatory light polypeptide 9 (MYL9), also known as MLC2, belongs to the myosin regulatory subunits. It plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation at Thr19 and Ser20. Implicated in cytokinesis, receptor capping, and cell locomotion (PMID:11942626, PMID:2526655). Some studies have demonstrated that MYL9 may play important roles in various human cancers. The expression and phosphorylation of MYL9 (Thr19\/Ser20) may be increased in human breast (PMID: 22144583) and liver cancers (PMID: 18648664), while decreased in human colon (PMID: 22752057) and bladder cancers (PMID: 21139803). MYL9 was the only gene differentially expressed in the aged versus young injured arteries in the rat smooth muscle cell layers (PMID:22003410).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7600 Product name: Recombinant human MYL9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002648 Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD Predict reactive species\nFull Name: myosin, light chain 9, regulatory\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC002648\nGene Symbol: MYL9\nGene ID (NCBI): 10398\nRRID: AB_2147773\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24844\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907229353,"sku":"15354-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15354-1-ap","provider":"Iright","version":"1.0","type":"link"}