{"product_id":"proteintech-15368-1-ap","title":"Proteintech, 15368-1-AP, COX8A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX8A (15368-1-AP) by Proteintech is a Polyclonal antibody targeting COX8A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15368-1-AP targets COX8A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  human skeletal muscle tissue\nPositive IHC detected in: mouse heart tissue, human hepatocirrhosis tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2885 Product name: Recombinant human COX8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC063025 Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE Predict reactive species\nFull Name: cytochrome c oxidase subunit 8A (ubiquitous)\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC063025\nGene Symbol: COX8A\nGene ID (NCBI): 1351\nRRID: AB_10697832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10176\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995932329,"sku":"15368-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15368-1-ap","provider":"Iright","version":"1.0","type":"link"}