{"product_id":"proteintech-15371-1-ap","title":"Proteintech, 15371-1-AP, GLRB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLRB (15371-1-AP) by Proteintech is a Polyclonal antibody targeting GLRB in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n15371-1-AP targets GLRB in WB, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  mouse spinal cord tissue\nPositive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4429 Product name: Recombinant human GLRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-267 aa of BC032635 Sequence: VEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVG Predict reactive species\nFull Name: glycine receptor, beta\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC032635\nGene Symbol: GLRB\nGene ID (NCBI): 2743\nRRID: AB_2878132\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869463204009,"sku":"15371-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15371-1-ap","provider":"Iright","version":"1.0","type":"link"}