{"product_id":"proteintech-15408-1-ap","title":"Proteintech, 15408-1-AP, ATP5E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5E (15408-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5E in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n15408-1-AP targets ATP5E in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, 37℃ incubated mouse heart tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP synthase epsilon subunit (ATP5E) is an important subunit of ATP synthase, which is located in the stalk region of the F1 sector. F1-ATPase is the catalytic portion of mitochondrial ATP synthase, which produces ATP from ADP and inorganic phosphate (Pi). ATP5E is widely expressed in tissues. The calculated molecular weight of ATP5E is 6 kDa (PMID: 36625260).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7672 Product name: Recombinant human ATP5E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC001690 Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit\nCalculated Molecular Weight: 6 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC001690\nGene Symbol: ATP5E\nGene ID (NCBI): 514\nRRID: AB_3085461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56381\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885113331881,"sku":"15408-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15408-1-ap","provider":"Iright","version":"1.0","type":"link"}