{"product_id":"proteintech-15471-1-ap","title":"Proteintech, 15471-1-AP, LIMD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIMD2 (15471-1-AP) by Proteintech is a Polyclonal antibody targeting LIMD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15471-1-AP targets LIMD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, Raji cells\nPositive IHC detected in: human ovary cancer tissue, human brain tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7775 Product name: Recombinant human LIMD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC004400 Sequence: MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA Predict reactive species\nFull Name: LIM domain containing 2\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC004400\nGene Symbol: LIMD2\nGene ID (NCBI): 80774\nRRID: AB_10859817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BT23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555085481,"sku":"15471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15471-1-ap","provider":"Iright","version":"1.0","type":"link"}