{"product_id":"proteintech-15475-1-ap","title":"Proteintech, 15475-1-AP, UBE2D1\/2\/3\/4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2D1\/2\/3\/4 (15475-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2D1\/2\/3\/4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15475-1-AP targets UBE2D1\/2\/3\/4 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human testis tissue,  rat brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1\/2\/3\/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7779 Product name: Recombinant human UBE2D4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC004104 Sequence: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2D 4 (putative)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC004104\nGene Symbol: UBE2D4\nGene ID (NCBI): 51619\nRRID: AB_2210167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2X8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869507080361,"sku":"15475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15475-1-ap","provider":"Iright","version":"1.0","type":"link"}