{"product_id":"proteintech-15485-1-ap","title":"Proteintech, 15485-1-AP, RAB31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB31 (15485-1-AP) by Proteintech is a Polyclonal antibody targeting RAB31 in WB, IHC, IP, ELISA applications with reactivity to human samples\n15485-1-AP targets RAB31 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue,  HepG2 cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human liver cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB31, also named as RAB22b, belongs to small GTP-binding proteins of the RAB family. Rab31 localizes in the trans-Golgi network (TGN) and endosomes. It is required for transport of mannose 6-phosphate receptors (MPRs) from the trans-Golgi network (TGN) to endosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7833 Product name: Recombinant human RAB31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-195 aa of BC001148 Sequence: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC Predict reactive species\nFull Name: RAB31, member RAS oncogene family\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC001148\nGene Symbol: RAB31\nGene ID (NCBI): 11031\nRRID: AB_2176911\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13636\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869579464873,"sku":"15485-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15485-1-ap","provider":"Iright","version":"1.0","type":"link"}