{"product_id":"proteintech-15516-1-ap","title":"Proteintech, 15516-1-AP, HSD3B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSD3B2 (15516-1-AP) by Proteintech is a Polyclonal antibody targeting HSD3B2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15516-1-AP targets HSD3B2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in placenta and skin (PMID:1682237). HSD3B2 plays a crucial role in steroid hormone biosynthesis and is thus of particular interest in hormone dependent tumors such as prostate cancer. Compared with normal tissue cytoplasmic HSD3B2 staining was stronger in prostate cancers (PMID: 29803408). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7782 Product name: Recombinant human HSD3B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-286 aa of BC038419 Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP Predict reactive species\nFull Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC038419\nGene Symbol: HSD3B2\nGene ID (NCBI): 3284\nRRID: AB_2120111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902379689,"sku":"15516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15516-1-ap","provider":"Iright","version":"1.0","type":"link"}