{"product_id":"proteintech-15527-1-ap","title":"Proteintech, 15527-1-AP, PRSS8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRSS8 (15527-1-AP) by Proteintech is a Polyclonal antibody targeting PRSS8 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n15527-1-AP targets PRSS8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse ovary tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtease serine S1 family member 8 (PRSS8), a membrane-anchored serine protease, has been reported to be involved in the development of several human cancers. PRSS8 protein level was highly expressed in well differentiated cancer cell and was lower or absent in poorly differentiated cancer cell. Significantly higher levels of prostasin were found in early stage OVC serum samples compared to benign ovarian and normal donor samples. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of OVC. (PMID: 27036110, PMID: 27050145)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7234 Product name: Recombinant human PRSS8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-325 aa of BC001462 Sequence: SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL Predict reactive species\nFull Name: protease, serine, 8\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC001462\nGene Symbol: PRSS8\nGene ID (NCBI): 5652\nRRID: AB_2172168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907950249,"sku":"15527-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15527-1-ap","provider":"Iright","version":"1.0","type":"link"}